| Edit |   |
| Antigenic Specificity | TMEM89 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM89 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM89. This antibody reacts with human. The TMEM89 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TMEM89 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RPLWYQVGLDLQPWGCQPKSVEGCRGGLSCPGYWLGPGA |
| Other Names | transmembrane protein 89 |
| Gene, Accession # | TMEM89, Gene ID: 440955, Accession: A2RUT3, SwissProt: A2RUT3 |
| Catalog # | NBP2-30826 |
| Price | |
| Order / More Info | TMEM89 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |