| Edit |   |
|---|
| Antigenic Specificity | TMEM75 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM75 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM75. This antibody reacts with human. The TMEM75 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM75(transmembrane protein 75) The peptide sequence was selected from the C terminal of TMEM75. Peptide sequence VTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVS. |
|---|
| Other Names | FLJ36105, transmembrane protein 75 |
|---|
| Gene, Accession # | TMEM75, Gene ID: 641384, Accession: Q8N9X5, SwissProt: Q8N9X5 |
|---|
| Catalog # | NBP1-59685 |
|---|
| Price | |
|---|
| Order / More Info | TMEM75 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|