| Edit |   |
|---|
| Antigenic Specificity | TMEM74 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM74 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM74. This antibody reacts with human. The TMEM74 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM74(transmembrane protein 74) The peptide sequence was selected from the middle region of TMEM74. Peptide sequence ERLEKESARLGAHLDRCVIAGLCLLTLGGVILSCLLMMSMWKGELYRRNR. |
|---|
| Other Names | FLJ30668, NET36, transmembrane protein 74 |
|---|
| Gene, Accession # | TMEM74, Gene ID: 157753, Accession: Q96NL1, SwissProt: Q96NL1 |
|---|
| Catalog # | NBP1-60092-20ul |
|---|
| Price | |
|---|
| Order / More Info | TMEM74 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|