| 产品详情 |
| Edit |   |
| Antigenic Specificity | PITPNM3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PITPNM3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PITPNM3. This antibody reacts with human. The PITPNM3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PITPNM3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RFPLGDGQSLLLADALHTHSPLFLEGSSRDSPPLLDAPASPPQASRFQRPGRRMSEGSSHSESSESSDSMAPVGASRITAKWWGSKRIDYALYCPDV |
| Other Names | membrane-associated phosphatidylinositol transfer protein 3, MGC157740, MGC157741, NIR-1, NIR1CORD5, Phosphatidylinositol transfer protein, membrane-associated 3, PITPnm 3, PITPNM family member 3, Pyk2 N-terminal domain-interacting receptor 1, RDGBA3, retinal degeneration B alpha 3 |
| Gene, Accession # | PITPNM3, Gene ID: 83394, Accession: Q9BZ71, SwissProt: Q9BZ71 |
| Catalog # | NBP2-33894 |
| Price | |
| Order / More Info | PITPNM3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|