| Edit |   |
| Antigenic Specificity | ADO |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 93%, rat 28%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines., Recombinant expression validation in WB using target protein overexpression. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human ADO polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAG |
| Other Names | 2-aminoethanethiol (cysteamine) dioxygenase, C10orf22, FLJ14547 |
| Gene, Accession # | Gene ID: 84890, UniProt: Q96SZ5, ENSG00000181915 |
| Catalog # | HPA039194 |
| Price | |
| Order / More Info | ADO Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |