| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | C9orf72 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C9orf72 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C9orf72. This antibody reacts with human, rat. The C9orf72 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C9orf72 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEI |
|---|
| Other Names | ALSFTD, chromosome 9 open reading frame 72, FTDALS |
|---|
| Gene, Accession # | C9orf72, Gene ID: 203228, Accession: Q96LT7, SwissProt: Q96LT7 |
|---|
| Catalog # | NBP1-93504 |
|---|
| Price | |
|---|
| Order / More Info | C9orf72 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22300873, 22426854, 22898310, 25521377 |
|---|
| 产品资料 |
|
|