| Edit |   |
|---|
| Antigenic Specificity | C9orf64 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C9orf64 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C9orf64. This antibody reacts with human. The C9orf64 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human C9orf64. Peptide sequence EMLSYGDRQEVEIRGCSLWCVELIRDCLLELIEQKGEKPNGEINSILLDY. |
|---|
| Other Names | chromosome 9 open reading frame 64, hypothetical protein LOC84267, RP11-575L7.5 |
|---|
| Gene, Accession # | C9ORF64, Gene ID: 84267, Accession: NP_115683, SwissProt: NP_115683 |
|---|
| Catalog # | NBP1-91505-20ul |
|---|
| Price | |
|---|
| Order / More Info | C9orf64 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|