| Edit |   |
|---|
| Antigenic Specificity | C9orf153 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C9orf153 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C9orf153. This antibody reacts with human. The C9orf153 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human C9orf153. Peptide sequence NEAQEVLARNLNVMSFTRGADVRGDLQPVISVNKMNKPGKHRKTPSPKIN. |
|---|
| Other Names | bA507D14.1, chromosome 9 open reading frame 153, hypothetical protein LOC389766, MGC131702 |
|---|
| Gene, Accession # | C9ORF153, Gene ID: 389766, Accession: EAW62711, SwissProt: EAW62711 |
|---|
| Catalog # | NBP1-91452 |
|---|
| Price | |
|---|
| Order / More Info | C9orf153 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|