| Edit |   |
|---|
| Antigenic Specificity | C7orf61 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C7orf61 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C7orf61. This antibody reacts with human. The C7orf61 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LOC402573(hypothetical LOC402573) The peptide sequence was selected from the C terminal of LOC402573. Peptide sequence YLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL. |
|---|
| Other Names | chromosome 7 open reading frame 61, hypothetical protein LOC402573, IMAGE:4839025 |
|---|
| Gene, Accession # | C7ORF61, Gene ID: 402573 |
|---|
| Catalog # | NBP1-56948-20ul |
|---|
| Price | |
|---|
| Order / More Info | C7orf61 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|