| Edit |   |
|---|
| Antigenic Specificity | C7orf31 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C7orf31 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C7orf31. This antibody reacts with human. The C7orf31 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C7ORF31 The peptide sequence was selected from the N terminal of C7ORF31. Peptide sequence EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRE. |
|---|
| Other Names | chromosome 7 open reading frame 31, hypothetical protein LOC136895 |
|---|
| Gene, Accession # | C7ORF31, Gene ID: 136895, Accession: Q8N865, SwissProt: Q8N865 |
|---|
| Catalog # | NBP1-56351 |
|---|
| Price | |
|---|
| Order / More Info | C7orf31 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|