| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PDE1A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PDE1A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDE1A. This antibody reacts with human. The PDE1A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PDE1A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSLILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAE |
|---|
| Other Names | 3'-5' cyclic nucleotide phosphodiesterase, 61 kDa Cam-PDE, calcium/calmodulin-dependent 3'-5'-cyclic nucleotide phosphodiesterase 1A, calcium/calmodulin-stimulated cyclic nucleotide phosphodiesterase, calmodulin-dependent phosphodiesterase, Cam-PDE 1A, EC 3.1.4, EC 3.1.4.17, hCam-1, HCAM1, HSPDE1A, MGC26303, phosphodiesterase 1A, calmodulin-dependent, phosphodiesterase-1A |
|---|
| Gene, Accession # | PDE1A, Gene ID: 5136 |
|---|
| Catalog # | NBP1-86009 |
|---|
| Price | |
|---|
| Order / More Info | PDE1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|