| 产品详情 |
| Edit |   |
| Antigenic Specificity | PDE11A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PDE11A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDE11A. This antibody reacts with human, mouse, rat. The PDE11A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat PDE11A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA |
| Other Names | cAMP and cGMP cyclic nucleotide phosphodiesterase 11A, cAMP and cGMP phosphodiesterase 11A, cyclic nucleotide phosphodiesterase 11A, dual 3'-5'-cyclic-AMP and -GMP phosphodiesterase 11A, EC 3.1.4, EC 3.1.4.17, EC 3.1.4.35, FLJ23693, MGC133355, MGC133356, PDE11A1, PDE11A2, PDE11A3, phosphodiesterase 11A, PPNAD2 |
| Gene, Accession # | PDE11A, Gene ID: 50940 |
| Catalog # | NBP1-85919 |
| Price | |
| Order / More Info | PDE11A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|