| 产品详情 |
| Edit |   |
| Antigenic Specificity | PDCL3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. ICC/IF reported in scientific literature (PMID: 26059764). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PDCL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDCL3. This antibody reacts with human, mouse, rat. The PDCL3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat PDCL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERAIEMYRRRRLAEWKATKLK |
| Other Names | HTPHLP, IAP-associated factor VIAF1, MGC3062, PHLP3, phosducin-like 3, phosducin-like protein 3, PhPL3, VIAF, VIAF-1, VIAF1PHLP2A, Viral IAP-associated factor 1 |
| Gene, Accession # | PDCL3, Gene ID: 79031, Accession: Q9H2J4 |
| Catalog # | NBP1-80626 |
| Price | |
| Order / More Info | PDCL3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26059764 |
| 产品资料 |
|
|