| Edit |   |
| Antigenic Specificity | PDCD2L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PDCD2L Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDCD2L. This antibody reacts with human. The PDCD2L Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human PDCD2LThe immunogen for this antibody is PDCD2L. Peptide sequence FACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGA. |
| Other Names | MGC13096, programmed cell death 2-like, programmed cell death protein 2-like |
| Gene, Accession # | PDCD2L, Gene ID: 84306, Accession: NP_115722, SwissProt: NP_115722 |
| Catalog # | NBP1-79403-20ul |
| Price | |
| Order / More Info | PDCD2L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |