| 产品详情 |
| Edit |   |
| Antigenic Specificity | MKK4/MEK4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MKK4/MEK4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MKK4/MEK4. This antibody reacts with human. The MKK4/MEK4 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human MKK4/MEK4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PAVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEI |
| Other Names | c-Jun N-terminal kinase kinase 1, dual specificity mitogen-activated protein kinase kinase 4, JNK activating kinase 1, JNK-activated kinase 1, JNK-activating kinase 1, JNKK, JNKK1MAPK/ERK kinase 4, MAP kinase kinase 4, MAPKK4, MEK4MEK 4, mitogen-activated protein kinase kinase 4, MKK4SAPK/ERK kinase 1, PRKMK4MAPKK 4, SEK1, SERK1EC 2.7.12.2 |
| Gene, Accession # | MAP2K4, Gene ID: 6416 |
| Catalog # | NBP2-57194 |
| Price | |
| Order / More Info | MKK4/MEK4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|