| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Calcineurin B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Calcineurin B Antibody from Novus Biologicals is a rabbit polyclonal antibody to Calcineurin B. This antibody reacts with human. The Calcineurin B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PPP3R1(protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform) The peptide sequence was selected from the N terminal of PPP3R1. Peptide sequence MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSV |
|---|
| Other Names | calcineurin subunit B type 1, CNA2, CNB1, Protein phosphatase 2B regulatory subunit 1, protein phosphatase 2B regulatory subunit B alpha, protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform(calcineurin B, type I), protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform(calcineurin B, type I), protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform, Protein phosphatase 3 regulatory subunit B alpha isoform 1, protein phosphatase 3, regulatory subunit B, alpha, type I (19kDa) |
|---|
| Gene, Accession # | PPP3R1, Gene ID: 5534, Accession: P63098, SwissProt: P63098 |
|---|
| Catalog # | NBP1-56816-20ul |
|---|
| Price | |
|---|
| Order / More Info | Calcineurin B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|