| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Calcineurin B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Calcineurin B Antibody from Novus Biologicals is a rabbit polyclonal antibody to Calcineurin B. This antibody reacts with human. The Calcineurin B Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | PPP3R1 (NP_000936.1, 1 a.a. - 170 a.a.) full-length human protein. MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV |
|---|
| Other Names | calcineurin subunit B type 1, CNA2, CNB1, Protein phosphatase 2B regulatory subunit 1, protein phosphatase 2B regulatory subunit B alpha, protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform(calcineurin B, type I), protein phosphatase 3 (formerly 2B), regulatory subunit B, 19kDa, alpha isoform(calcineurin B, type I), protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform, Protein phosphatase 3 regulatory subunit B alpha isoform 1, protein phosphatase 3, regulatory subunit B, alpha, type I (19kDa) |
|---|
| Gene, Accession # | PPP3R1, Gene ID: 5534, Accession: NP_000936.1, SwissProt: NP_000936.1 |
|---|
| Catalog # | H00005534-D01P |
|---|
| Price | |
|---|
| Order / More Info | Calcineurin B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|