| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Calcineurin A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Calcineurin A Antibody from Novus Biologicals is a rabbit polyclonal antibody to Calcineurin A. This antibody reacts with human, rat. The Calcineurin A Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PPP3CA(protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform) The peptide sequence was selected from the N terminal of PPP3CA. Peptide sequence MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRV |
|---|
| Other Names | calcineurin A alpha, Calmodulin-dependent calcineurin A subunit alpha isoform, CALN, CALNAcatalytic subunit, alpha isoform, CAM-PRP catalytic subunit, CNA, CNA1CALNA1, EC 3.1.3.16, PPP2BCCN1, protein phosphatase 2B, catalytic subunit, alpha isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform(calcineurin A alpha), protein phosphatase 3, catalytic subunit, alpha isozyme, serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform |
|---|
| Gene, Accession # | PPP3CA, Gene ID: 5530, Accession: P63329 |
|---|
| Catalog # | NBP1-57844 |
|---|
| Price | |
|---|
| Order / More Info | Calcineurin A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|