| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Calcineurin A |
|---|
| Clone | 2G8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Calcineurin A Antibody (2G8) from Novus Biologicals is a mouse monoclonal antibody to Calcineurin A. This antibody reacts with human, rat. The Calcineurin A Antibody (2G8) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | PPP3CA (NP_000935, 1 a.a. - 84 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAP |
|---|
| Other Names | calcineurin A alpha, Calmodulin-dependent calcineurin A subunit alpha isoform, CALN, CALNAcatalytic subunit, alpha isoform, CAM-PRP catalytic subunit, CNA, CNA1CALNA1, EC 3.1.3.16, PPP2BCCN1, protein phosphatase 2B, catalytic subunit, alpha isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform(calcineurin A alpha), protein phosphatase 3, catalytic subunit, alpha isozyme, serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform |
|---|
| Gene, Accession # | PPP3CA, Gene ID: 5530, Accession: NP_000935, SwissProt: NP_000935 |
|---|
| Catalog # | H00005530-M03 |
|---|
| Price | |
|---|
| Order / More Info | Calcineurin A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18835920 |
|---|
| 产品资料 |
|
|