| Edit |   |
|---|
| Antigenic Specificity | Nucleoplasmin-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nucleoplasmin-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nucleoplasmin-2. This antibody reacts with human. The Nucleoplasmin-2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NPM2(nucleophosmin/nucleoplasmin, 2) The peptide sequence was selected from the N terminal of NPM2 (NP_877724). Peptide sequence LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA. |
|---|
| Other Names | MGC78655, nucleophosmin/nucleoplasmin 2, nucleoplasmin-2 |
|---|
| Gene, Accession # | NPM2, Gene ID: 10361, Accession: Q86SE8, SwissProt: Q86SE8 |
|---|
| Catalog # | NBP1-58109 |
|---|
| Price | |
|---|
| Order / More Info | Nucleoplasmin-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|