| Edit |   |
| Antigenic Specificity | Nucleoplasmin-2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Nucleoplasmin-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nucleoplasmin-2. This antibody reacts with human. The Nucleoplasmin-2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to NPM2(nucleophosmin/nucleoplasmin, 2) The peptide sequence was selected from the N terminal of NPM2 (NP_877724). Peptide sequence LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA. |
| Other Names | MGC78655, nucleophosmin/nucleoplasmin 2, nucleoplasmin-2 |
| Gene, Accession # | NPM2, Gene ID: 10361, Accession: Q86SE8, SwissProt: Q86SE8 |
| Catalog # | NBP1-58109-20ul |
| Price | |
| Order / More Info | Nucleoplasmin-2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |