| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TMED3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reactivity reported in (PMID: 24920608). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMED3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMED3. This antibody reacts with human. The TMED3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TMED3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VGDEPPILPDMGNRVTALTQRFRGAYWKEVDKMVDYMQPGGTPATEGLGR LAPS |
|---|
| Other Names | C15orf22, chromosome 15 open reading frame 22, integral type I protein, Membrane protein p24B, MGC133022, p24B, transmembrane emp24 domain containing 3, transmembrane emp24 domain-containing protein 3, transmembrane emp24 protein transport domain containing 3,1200002G13Rik |
|---|
| Gene, Accession # | TMED3, Gene ID: 23423 |
|---|
| Catalog # | NBP2-13439 |
|---|
| Price | |
|---|
| Order / More Info | TMED3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24920608 |
|---|
| 产品资料 |
|
|