| Edit |   |
| Antigenic Specificity | CDCA5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CDCA5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDCA5. This antibody reacts with human. The CDCA5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CDCA5(cell division cycle associated 5) The peptide sequence was selected from the middle region of CDCA5. Peptide sequence ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST. |
| Other Names | cell division cycle associated 5, Cell division cycle-associated protein 5, MGC16386, p35, SORORIN |
| Gene, Accession # | CDCA5, Gene ID: 113130, Accession: Q96FF9, SwissProt: Q96FF9 |
| Catalog # | NBP1-55144 |
| Price | |
| Order / More Info | CDCA5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |