| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDCA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. IP, WB, ICC/IF reported in scientific literature (PMID: 26674376). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDCA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDCA2. This antibody reacts with human. The CDCA2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. Specificity of human CDCA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IKCERKDDFLGAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGRSLHLEKNGNHTPSS |
|---|
| Other Names | cell division cycle associated 2, cell division cycle-associated protein 2, FLJ25804, MGC129906, MGC129907, protein phosphatase 1 [gamma] (PPP1R3A) binding protein Repo-Man, Repo-ManRecruits PP1 onto mitotic chromatin at anaphase protein |
|---|
| Gene, Accession # | CDCA2, Gene ID: 157313 |
|---|
| Catalog # | NBP1-87140 |
|---|
| Price | |
|---|
| Order / More Info | CDCA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26674376 |
|---|
| 产品资料 |
|
|