| 产品详情 |
| Edit |   |
| Antigenic Specificity | CDC7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CDC7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDC7. This antibody reacts with human. The CDC7 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CDC7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREY |
| Other Names | CDC7 (cell division cycle 7, S. cerevisiae, homolog)-like 1, CDC7 cell division cycle 7 (S. cerevisiae), CDC7L1MGC117361, CDC7-related kinase, cell division cycle 7 (S. cerevisiae), cell division cycle 7 homolog (S. cerevisiae), cell division cycle 7-like protein 1, cell division cycle 7-related protein kinase, EC 2.7.11.1, HsCdc7, Hsk1, huCdc7, MGC126237, MGC126238 |
| Gene, Accession # | CDC7, Gene ID: 8317 |
| Catalog # | NBP2-32708 |
| Price | |
| Order / More Info | CDC7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|