| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDC25C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDC25C Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDC25C. This antibody reacts with human. The CDC25C Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CDC25C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQL |
|---|
| Other Names | CDC 25, CDC25, cell division cycle 25 homolog C (S. cerevisiae), cell division cycle 25 homolog C (S. pombe), cell division cycle 25C, Dual specificity phosphatase Cdc25C, EC 3.1.3.48, mitosis inducer CDC25, M-phase inducer phosphatase 3, phosphotyrosine phosphatase |
|---|
| Gene, Accession # | CDC25C, Gene ID: 995 |
|---|
| Catalog # | NBP2-57705 |
|---|
| Price | |
|---|
| Order / More Info | CDC25C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|