| Edit |   |
|---|
| Antigenic Specificity | TMEM147 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM147 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM147. This antibody reacts with rat. The TMEM147 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Tmem147. Peptide sequence VTYLFVQLCKMLFLATFFPTWEGGIYDFIGEFMKASVDVADLIGLNLVMS. |
|---|
| Other Names | MGC1936, NIFIE14, Protein NIFIE 14, seven transmembrane domain protein, transmembrane protein 147 |
|---|
| Gene, Accession # | TMEM147, Gene ID: 10430, Accession: NP_001033583 |
|---|
| Catalog # | NBP1-79334-20ul |
|---|
| Price | |
|---|
| Order / More Info | TMEM147 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|