| Edit |   |
|---|
| Antigenic Specificity | TMEM144 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM144 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM144. This antibody reacts with human. The TMEM144 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human TMEM144. Peptide sequence LSTVHHRIVGCSLAVISGVLYGSTFVPIIYIKDHSKRNDSIYAGASQYDL. |
|---|
| Other Names | transmembrane protein 144 |
|---|
| Gene, Accession # | TMEM144, Gene ID: 55314, Accession: NP_060812, SwissProt: NP_060812 |
|---|
| Catalog # | NBP1-91310 |
|---|
| Price | |
|---|
| Order / More Info | TMEM144 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|