| Edit |   |
|---|
| Antigenic Specificity | TMEM141 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM141 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM141. This antibody reacts with human. The TMEM141 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is TMEM141. Peptide sequence PLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS. |
|---|
| Other Names | MGC14141, RP11-216L13.7, transmembrane protein 141 |
|---|
| Gene, Accession # | TMEM141, Gene ID: 85014, Accession: NP_116317, SwissProt: NP_116317 |
|---|
| Catalog # | NBP1-79868-20ul |
|---|
| Price | |
|---|
| Order / More Info | TMEM141 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|