| Edit |   |
|---|
| Antigenic Specificity | TMEM139 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM139 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM139. This antibody reacts with human. The TMEM139 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM139 (transmembrane protein 139) The peptide sequence was selected from the N terminal of TMEM139. Peptide sequence ITPVAYFFLTLGGFFLFAYLLVRFLEWGLRSQLQSMQTESPGPSGNARDN. |
|---|
| Other Names | FLJ90586, transmembrane protein 139 |
|---|
| Gene, Accession # | TMEM139, Gene ID: 135932, Accession: Q8IV31, SwissProt: Q8IV31 |
|---|
| Catalog # | NBP1-70726 |
|---|
| Price | |
|---|
| Order / More Info | TMEM139 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|