| Edit |   |
|---|
| Antigenic Specificity | TMEM135 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM135 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM135. This antibody reacts with human. The TMEM135 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM135(transmembrane protein 135) The peptide sequence was selected from the N terminal of TMEM135. Peptide sequence SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC. |
|---|
| Other Names | DKFZp686I1974, FLJ22104, transmembrane protein 135 |
|---|
| Gene, Accession # | TMEM135, Gene ID: 65084, Accession: Q86UB9, SwissProt: Q86UB9 |
|---|
| Catalog # | NBP1-59377 |
|---|
| Price | |
|---|
| Order / More Info | TMEM135 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|