| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TMEM119 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat, porcine, feline |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID : 29109020). IHC-Frozen reactivity per customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM119 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM119. This antibody reacts with human, rat, porcine, feline. The TMEM119 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Specificity of human, rat TMEM119 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ITRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALD |
|---|
| Other Names | OBIF, Osteoblast Induction Factor, TMEM119 |
|---|
| Gene, Accession # | TMEM119, Gene ID: 338773, Accession: Q4V9L6, SwissProt: Q4V9L6 |
|---|
| Catalog # | NBP2-30551 |
|---|
| Price | |
|---|
| Order / More Info | TMEM119 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29109020 |
|---|
| 产品资料 |
|
|