| Edit |   |
| Antigenic Specificity | TMEM117 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM117 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM117. This antibody reacts with human. The TMEM117 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human TMEM117. Peptide sequence GQYIGPGQKIYTVKDSESLKDLNRTKLSWEWRSNHTNPRTNKTYVEGDMF. |
| Other Names | transmembrane protein 117 |
| Gene, Accession # | TMEM117, Gene ID: 84216, Accession: AAH30284, SwissProt: AAH30284 |
| Catalog # | NBP1-91358 |
| Price | |
| Order / More Info | TMEM117 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |