| Edit |   |
| Antigenic Specificity | TMEM115 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 50ul |
| Concentration | lyophilized |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM115 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM115. This antibody reacts with human. The TMEM115 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TMEM115(transmembrane protein 115) The peptide sequence was selected from the N terminal of TMEM115. Peptide sequence LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVV. |
| Other Names | PL6Placental protein 6, PP6, Protein PL6, transmembrane protein 115 |
| Gene, Accession # | TMEM115, Gene ID: 11070, Accession: Q12893, SwissProt: Q12893 |
| Catalog # | NBP1-69572 |
| Price | |
| Order / More Info | TMEM115 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |