| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TMEM115 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF and WB reported in the literature (PMID: 24806965) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM115 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM115. This antibody reacts with human. The TMEM115 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TMEM115 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITF |
|---|
| Other Names | PL6Placental protein 6, PP6, Protein PL6, transmembrane protein 115 |
|---|
| Gene, Accession # | TMEM115, Gene ID: 11070, Accession: Q12893 |
|---|
| Catalog # | NBP1-80898 |
|---|
| Price | |
|---|
| Order / More Info | TMEM115 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24806965 |
|---|
| 产品资料 |
|
|