| Edit |   |
| Antigenic Specificity | TMEM109 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM109 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM109. This antibody reacts with human. The TMEM109 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human TMEM109. Peptide sequence GIAAQLLNALGLAGDYLAQGLKLSPGQVQTFLLWGAGALVVYWLLSLLLG. |
| Other Names | transmembrane protein 109 |
| Gene, Accession # | TMEM109, Gene ID: 79073, Accession: NP_076997, SwissProt: NP_076997 |
| Catalog # | NBP1-91346-20ul |
| Price | |
| Order / More Info | TMEM109 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |