| Edit |   |
|---|
| Antigenic Specificity | Clathrin light chain |
|---|
| Clone | 4E9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. It has been used for ELISA and WB. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Clathrin light chain Antibody (4E9) from Novus Biologicals is a mouse monoclonal antibody to Clathrin light chain. This antibody reacts with human. The Clathrin light chain Antibody (4E9) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CLTA (NP_001824.1 118 a.a. - 176 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESS |
|---|
| Other Names | clathrin light chain A, clathrin, light chain A, LCA, light polypeptide (Lca) |
|---|
| Gene, Accession # | CLTA, Gene ID: 1211, Accession: NP_001824, SwissProt: NP_001824 |
|---|
| Catalog # | H00001211-M08 |
|---|
| Price | |
|---|
| Order / More Info | Clathrin light chain Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|