| Edit |   |
|---|
| Antigenic Specificity | GLI Pathogenesis-Related 1 Like 1 (GLIPR1L1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GLIPR1L1 is a novel testis-specific CAP protein and is presented to the acrosomal cap following in vitro capacitation. |
|---|
| Immunogen | GLIPR1 L1 antibody was raised using the middle region of GLIPR1 1 corresponding to a region with amino acids NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL |
|---|
| Other Names | 1700011E04Rik|ALKN2972|PRO7434 |
|---|
| Gene, Accession # | Gene ID: 256710 |
|---|
| Catalog # | ABIN633140 |
|---|
| Price | |
|---|
| Order / More Info | GLI Pathogenesis-Related 1 Like 1 (GLIPR1L1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|