| Edit |   |
|---|
| Antigenic Specificity | Clathrin light chain |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Clathrin light chain Antibody from Novus Biologicals is a rabbit polyclonal antibody to Clathrin light chain. This antibody reacts with human. The Clathrin light chain Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Clathrin light chain antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERV |
|---|
| Other Names | clathrin light chain A, clathrin, light chain A, LCA, light polypeptide (Lca) |
|---|
| Gene, Accession # | CLTA, Gene ID: 1211, Accession: P09496, SwissProt: P09496 |
|---|
| Catalog # | NBP2-38733 |
|---|
| Price | |
|---|
| Order / More Info | Clathrin light chain Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|