| Edit |   |
|---|
| Antigenic Specificity | Glioblastoma Amplified Sequence (GBAS) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Chromosomal region 7p12, which contains GBAS, is amplified in approximately 40% of glioblastomas, the most common and malignant form of central nervous system tumor. |
|---|
| Immunogen | GBAS antibody was raised using the middle region of GBAS corresponding to a region with amino acids VPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIG |
|---|
| Other Names | nipsnap2|wu:fc08b08|zgc:92497|NIPSNAP2|AV006093|Nipsnap2 |
|---|
| Gene, Accession # | Gene ID: 2631 |
|---|
| Catalog # | ABIN630560 |
|---|
| Price | |
|---|
| Order / More Info | Glioblastoma Amplified Sequence (GBAS) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|