| Edit |   |
|---|
| Antigenic Specificity | Serum Response Factor SRF |
|---|
| Clone | 2C9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Serum Response Factor SRF Antibody (2C9) from Novus Biologicals is a mouse monoclonal antibody to Serum Response Factor SRF. This antibody reacts with human. The Serum Response Factor SRF Antibody (2C9) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | SRF (NP_003122 244 a.a. - 332 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPV |
|---|
| Other Names | MCM1, serum response factor, serum response factor (c-fos serum response element-binding transcriptionfactor) |
|---|
| Gene, Accession # | SRF, Gene ID: 6722, Accession: NP_003122, SwissProt: NP_003122 |
|---|
| Catalog # | H00006722-M04 |
|---|
| Price | |
|---|
| Order / More Info | Serum Response Factor SRF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|