| Edit |   |
| Antigenic Specificity | Serum Amyloid A4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Serum Amyloid A4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Serum Amyloid A4. This antibody reacts with human. The Serum Amyloid A4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SAA4(serum amyloid A4, constitutive) The peptide sequence was selected from the middle region of SAA4. Peptide sequence AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF. |
| Other Names | C-SAACSAAConstitutively expressed serum amyloid A protein, serum amyloid A-4 protein, serum amyloid A4, constitutive |
| Gene, Accession # | SAA4, Gene ID: 6291, Accession: P35542, SwissProt: P35542 |
| Catalog # | NBP1-58991 |
| Price | |
| Order / More Info | Serum Amyloid A4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |