| 产品详情 |
| Edit |   |
| Antigenic Specificity | NSUN6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NSUN6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NSUN6. This antibody reacts with human, mouse, rat. The NSUN6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat NSUN6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLLIPVIGPRKNIKKQQCEAIVGAQCGNAVLRGAHVYAPGIVSASQFMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELSRKEIFSG |
| Other Names | EC 2.1.1, EC 2.1.1.-, EC 2.1.1.52, FLJ23743, NOL1/NOP2/Sun and PUA domain-containing protein 1, NOL1/NOP2/Sun domain family 6, NOL1/NOP2/Sun domain family member 6, NOL1/NOP2/Sun domain family, member 6, NOP2/Sun domain family, member 6,4933414E04Rik, NOPD1, nucleolar protein (NOL1/NOP2/sun) and PUA domains 1, putative methyltransferase NSUN6 |
| Gene, Accession # | NSUN6, Gene ID: 221078 |
| Catalog # | NBP1-92202 |
| Price | |
| Order / More Info | NSUN6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|