| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NSUN5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NSUN5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NSUN5. This antibody reacts with human. The NSUN5 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NSUN5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MPSRQLEDPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRL |
|---|
| Other Names | EC 2.1.1.-, FLJ10267, member 5A, MGC986, NOL1, NOL1/NOP2/Sun domain family member 5, NOL1/NOP2/Sun domain family, member 5, NOL1R(NOL1), NOL1-related protein, NOP2/Sun domain family, member 5, NSUN5A, p120, putative methyltransferase NSUN5, WBSCR20, WBSCR20A, Williams-Beuren syndrome chromosomal region 20A protein, Williams-Beuren syndrome critical region protein 20 copy A, Ynl022cL |
|---|
| Gene, Accession # | NSUN5, Gene ID: 55695 |
|---|
| Catalog # | NBP2-58249 |
|---|
| Price | |
|---|
| Order / More Info | NSUN5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|