| Edit |   |
| Antigenic Specificity | RERG |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RERG Antibody from Novus Biologicals is a rabbit polyclonal antibody to RERG. This antibody reacts with rat. The RERG Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Rerg. Peptide sequence NILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLASELACAFYECSA. |
| Other Names | MGC15754, RAS-like, estrogen-regulated, growth inhibitor, ras-related and estrogen-regulated growth inhibitor |
| Gene, Accession # | RERG, Gene ID: 85004, Accession: XP_001072746 |
| Catalog # | NBP1-79772 |
| Price | |
| Order / More Info | RERG Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |