| Edit |   |
|---|
| Antigenic Specificity | RER1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RER1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RER1. This antibody reacts with human. The RER1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | Synthetic peptides corresponding to RER1(RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of RER1. Peptide sequence GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEF |
|---|
| Other Names | protein RER1, RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae) |
|---|
| Gene, Accession # | RER1, Gene ID: 11079, Accession: O15258, SwissProt: O15258 |
|---|
| Catalog # | NBP1-59953 |
|---|
| Price | |
|---|
| Order / More Info | RER1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|