| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RENT1/UPF1/hUPF1 |
|---|
| Clone | 4G3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 50 ug |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RENT1/UPF1/hUPF1 Antibody (4G3) from Novus Biologicals is a mouse monoclonal antibody to RENT1/UPF1/hUPF1. This antibody reacts with human. The RENT1/UPF1/hUPF1 Antibody (4G3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | UPF1 (NP_002902.2 1019 a.a. - 1116 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLS |
|---|
| Other Names | ATP-dependent helicase RENT1, EC 3.6.1, EC 3.6.4.-, FLJ43809, HUPF1, KIAA0221FLJ46894, Nonsense mRNA reducing factor 1, NORF1delta helicase, pNORF1, regulator of nonsense transcripts 1, RENT1UP Frameshift 1, UPF1 regulator of nonsense transcripts homolog (yeast), up-frameshift mutation 1 homolog, Up-frameshift suppressor 1 homolog, yeast Upf1p homolog |
|---|
| Gene, Accession # | UPF1, Gene ID: 5976, Accession: NP_002902, SwissProt: NP_002902 |
|---|
| Catalog # | H00005976-M01-50ug |
|---|
| Price | |
|---|
| Order / More Info | RENT1/UPF1/hUPF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|