| 产品详情 |
| Edit |   |
| Antigenic Specificity | RENT1/UPF1/hUPF1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RENT1/UPF1/hUPF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RENT1/UPF1/hUPF1. This antibody reacts with human, mouse, rat. The RENT1/UPF1/hUPF1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human, mouse, rat RENT1/UPF1/hUPF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTD |
| Other Names | ATP-dependent helicase RENT1, EC 3.6.1, EC 3.6.4.-, FLJ43809, HUPF1, KIAA0221FLJ46894, Nonsense mRNA reducing factor 1, NORF1delta helicase, pNORF1, regulator of nonsense transcripts 1, RENT1UP Frameshift 1, UPF1 regulator of nonsense transcripts homolog (yeast), up-frameshift mutation 1 homolog, Up-frameshift suppressor 1 homolog, yeast Upf1p homolog |
| Gene, Accession # | UPF1, Gene ID: 5976 |
| Catalog # | NBP1-89641 |
| Price | |
| Order / More Info | RENT1/UPF1/hUPF1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|