| Edit |   |
|---|
| Antigenic Specificity | TYMS opposite strand |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TYMS opposite strand Antibody from Novus Biologicals is a rabbit polyclonal antibody to TYMS opposite strand. This antibody reacts with human. The TYMS opposite strand Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C18orf56 (chromosome 18 open reading frame 56) The peptide sequence was selected from the N terminal of C18orf56. Peptide sequence MTPASGATASLGRLRARPRSRWDAAYLPAVAAVCVARASHVPNGTLRFGV. |
|---|
| Other Names | chromosome 18 open reading frame 56, putative uncharacterized protein C18orf56 |
|---|
| Gene, Accession # | C18ORF56, Gene ID: 494514, Accession: Q8TAI1, SwissProt: Q8TAI1 |
|---|
| Catalog # | NBP1-57050 |
|---|
| Price | |
|---|
| Order / More Info | TYMS opposite strand Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|