| Edit |   |
| Antigenic Specificity | TEKT4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TEKT4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TEKT4. This antibody reacts with human. The TEKT4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TEKT4(tektin 4) The peptide sequence was selected from the N terminal of TEKT4. Peptide sequence TSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQ. |
| Other Names | MGC27019, tektin 4, tektin-4 |
| Gene, Accession # | TEKT4, Gene ID: 150483, Accession: Q8WW24, SwissProt: Q8WW24 |
| Catalog # | NBP1-57589 |
| Price | |
| Order / More Info | TEKT4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |